SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929744|ref|YP_002506653.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929744|ref|YP_002506653.1|
Domain Number 1 Region: 36-441
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.6e-66
Family beta-glycanases 0.0000102
Further Details:      
 
Domain Number 2 Region: 473-538
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.77e-17
Family Type I dockerin domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929744|ref|YP_002506653.1|
Sequence length 539
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKTISVFLALIMLLTLLIPSVTKVSAAEPGVAESGDDWLHVEGTNIVDKYGNKVWITGA
NWFGFNCRERMLLDSYHSNIVADIEIVADKGINVVRMPIATDLLYAWSKGEYPASTDTSY
NNADLTGLNSFELFNFMLDNFKRVGIKVILDVHSAETDNMGHTYPLWYNGTITEEVFKEA
WVWVANHYKNDDTIIGFDLKNEPHTNTGTLKMKSQSAIWDDSTHANNWKRVAQETALAIM
KVHPNALIFVEGVEMYPKDGLWNDESFDTSPWTGTNDYYGNWWGGNLRGVKDYPINLGAY
QKQLVYSPHDYGPMVFEQEWFKGSFPTCDDATAKKILYEQCWRDNWAYIMENGTSPLLIG
EWGGLTEGEDKLLEANKKYLRSMRDYILENKYQLHHTFWCINIDSADTGGLLTRGEGTAF
PGGRDLKWNDNKYDNYLYPVLWKNSEGKFIGLDHKIPLGKNGVLLGSPDDEPTINYGDIN
KDGQIDALDVIALKSYILGINQNIDTQAADLNKDSSIDALDMQILKRYLLGQVTQLPLG
Download sequence
Identical sequences B8I5D7
gi|220929744|ref|YP_002506653.1| WP_015925765.1.84728 394503.Ccel_2337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]