SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929818|ref|YP_002506727.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220929818|ref|YP_002506727.1|
Domain Number - Region: 100-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0234
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929818|ref|YP_002506727.1|
Sequence length 658
Comment glycosyl transferase family protein [Clostridium cellulolyticum H10]
Sequence
METYLKNILNFFSHVKMPGFATMMSSVIILFFIGIGIWGFSRIRNIQKGNLIITEYGLLD
NEKEKKPLFKLVKKDYIIMLVMTLLYAIPAIYNLGGFKIPETPWAPAEKNDGFIVDLGKE
VDVTKVMIYQGYNEEKYDGVKFNIKFLNSNDTYSDSEALEKSGFFSWKVSTKEFKTSKIK
IIADKPGSAINELAIFEKGSTKPFKVMSITSVDPLIKSSIKSPDGKPYKLSNLIDEQDRV
DLYTLSATNTYFDEVFYPRTALDFINKIHPFERTHPPLGKYFVMIGMLIFGVNPFGWRII
GTLFGVAMIPLMYLFGYKIFKKRFLAFCTAFLMMFDFMHFVQTRISTIDVYVTFFVILMY
YYIYDYFVKKSYKAGLKRSLVPLFLCGLAFGIGIATKWIAMYAAVGIFLILVIAKLDEIV
YYTAYKKSGLSSDLFSKFWSKYFFKTALFCILFFILIPGIIYFASYTSIMQVPDNGIKEF
FNNQSFMYSFHNDLNAKHSYSSQWFEWPIMTKPIWFYGSKALAAEKLTSSIICMGNPLIW
WISIPSLITGIIVAIKRKDKYMLVPIFGALFQYIPWMVVRRMAFIYHYFSVIPFIIIIIV
YLIKVFMELGGNTKKIVCTYLVLTAIVFIMYYPILSGMIVPRWYASLLQLFPGWSFRY
Download sequence
Identical sequences B8I5L1
394503.Ccel_2417 WP_015925836.1.84728 gi|220929818|ref|YP_002506727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]