SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929842|ref|YP_002506751.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929842|ref|YP_002506751.1|
Domain Number 1 Region: 378-629
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.82e-17
Family Papain-like 0.011
Further Details:      
 
Domain Number 2 Region: 797-867
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000366
Family Type I dockerin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 225-303
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000119
Family Fibronectin type III 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|220929842|ref|YP_002506751.1|
Domain Number - Region: 124-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000633
Family Beta-D-xylosidase C-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929842|ref|YP_002506751.1|
Sequence length 870
Comment cellulosome protein dockerin type I [Clostridium cellulolyticum H10]
Sequence
MKKRLKKASIVLALAVLVQCMMFNLGFETIQAGAVGIINKDYWNYRNIGNANEYSTADVF
TDKVIVAGSGSGVFNTEDSFTYSYIPVNGDCTIQARIVSESSTDALAKAGLMIRESLDTD
SKNAFIALSKSNQIQYQYRAMTGGATASDASISGNAPVYLKLTRVGDSFEAFMSTDGTNW
TKTGNTQTIAMGSKVYLGFASTSTDPNKLCTARFENIDIEYTDNTPPLAPTNLRVVYESQ
PSCQLAWDEASDDSGAVLYEIYSNGSLKRITHDCKSICPNIDFKNTVDLCVVAVDAKGNR
SPENSTIKIVSQNALISSADVTNIRLNSIGLERMNTKRQQQNKPLVEADPVQVGEEIMTD
STPNNVIVQGNSVDLNTIYAESLPSSVDNSTLQCFPRIDNQIYGDCVIWSTGYYTMTHMV
GLAKVNAGGQWDAKNDTTGSKVFSPKFAFSVGNAPSSTGLMTGVYKTYLDSGCATLADAP
YINDGVDGFKLSTDLDSWENAINYRMDKYGYIDANENSLERIKQLLNNGYVMSFDTGTYN
FMQYPNVVLDNPDPAVNDDYAVGKHFFYMVDGVNSGHQMTLVGYDDNIWWGDVNGDGIPQ
PEEKGLFKIANSWGSNYGYDGFVYVNYDSIYRNSQFSQFNSSTRMPIFKDVLEWMTPRRD
YVPQLIAEFTVSHAKADQLRIAVGYSDMDKNMPEAYFFPGSLNYLSHTEPFDFNVDGTAC
DGNFAVDMTDFITKFNLDKSKRYKWYLMVGDNEEDGSPVTLKSFRVHDKINNKYSTYRGP
ELQNDGDNSYVSVDYSWALVGDVDGNGIIDDADQLLIVDYSLGYINDFPVEDDMWAADVN
GDGIINMIDSAFIRKYILGQINIFPKQQLN
Download sequence
Identical sequences B8I606
394503.Ccel_2442 gi|220929842|ref|YP_002506751.1| WP_015925860.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]