SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929929|ref|YP_002506838.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929929|ref|YP_002506838.1|
Domain Number 1 Region: 109-246
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.98e-42
Family Ricin B-like 0.0061
Further Details:      
 
Domain Number 2 Region: 35-100
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000405
Family Type I dockerin domain 0.00081
Further Details:      
 
Weak hits

Sequence:  gi|220929929|ref|YP_002506838.1|
Domain Number - Region: 242-341
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000179
Family Matrix metalloproteases, catalytic domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929929|ref|YP_002506838.1|
Sequence length 412
Comment ricin B lectin [Clostridium cellulolyticum H10]
Sequence
MIMKIKGFIVAFTLLLTVIFNSGISSADGTVPGTSIIYGDCNSDGSINALDLAGFKQYLM
DSERTYNSGMDLNLDNTADSVDYAILKQYLLGIVTTLPINAPTTNIKTGVNYKIINRNSG
KLLDVSGSSVSEGGNVIQWGLTGGANQQWSFIDAGGGYYKIVNRNSGKLLEIMNSSVDNG
GGAVQGIDDGDNSQKWGFIDIGGGYYKIVNMGSGKLLEVLNTSTANGGDVAQWTDNGGSN
QQWYLVAQTTGNITYTLIREQNPTADQSDAYAKIKAAMDSAVMYYNNLTNISKQLTVYYN
TSVSTADGNINGTIRFGPSRSYMDTRTAIHEIAHTVGVGQSSGWFSLVKNGIFTGKSATE
ELRNITGVSTDVLHGDSQHFWPYGLNYSSEVRTDADYINHCRIVNQFKKDGV
Download sequence
Identical sequences B8I693
WP_015925947.1.84728 gi|220929929|ref|YP_002506838.1| 394503.Ccel_2530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]