SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929976|ref|YP_002506885.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929976|ref|YP_002506885.1|
Domain Number 1 Region: 2302-2822
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.02e-101
Family Glycosyltransferase family 36 C-terminal domain 0.000000936
Further Details:      
 
Domain Number 2 Region: 1531-1790
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-69
Family Glycosyltransferase family 36 N-terminal domain 0.00061
Further Details:      
 
Domain Number 3 Region: 2032-2293
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.13e-64
Family Glycosyltransferase family 36 N-terminal domain 0.00016
Further Details:      
 
Weak hits

Sequence:  gi|220929976|ref|YP_002506885.1|
Domain Number - Region: 623-650,718-805
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0525
Family Glycogenin 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929976|ref|YP_002506885.1|
Sequence length 2823
Comment carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MNNILILLIITLIAIVAALIGIVLKNRPSYEVQIEDVFLNSDDLMRHAEQLAKTQTTDKR
KLGIRRVRERIERNFHRVLEMYQKFNLDISASFPVPPAAEWLLDNFYIIEEQKSMLMKEL
SEVKQALPVISEGTYAGYPRVFAIAADLVSHCDGNVNEKIIRDFIAAYQKHTFLSIQELW
MLSTMLKAALLEKLWAVCDRMFTNRQDWYRAEGIVNGIRHNNENCDDFRRHIDQLEEITP
AFAEHLIKKLRKDGAKTLWMIECLDSILVQKSTSTDSLISEDHFNQATLQVSTGNVINSF
RALSGFDNTVLFEQLSEVERLLKLDPCGIYPQMDFDSRNYYRDIVMNLGSKYDTTEINIA
RLCLDLAREKYDENPSITAETHVGYYLAGKGRSAFSNKIGKYKEHSFKNCEKWYITAIVL
FSVVIALIPTVNSFSRENGRLAFIVLLTGILSIIPASEIVVSVLNSCISRIVKPARLPKL
ELNDGIPEDWATMVIIPTLIPNVKRTVELIDNLEVFYLANKGSNIYFSLAGDFKDSDDET
LSDDNEIVEAAIKRVQDLNRKYCKDAKPIFYFFCRKRRYNEKQKKWLGWERKRGAILEFN
RLLRRDRNTDYVFNSATIDSLPNIKYVITLDADTQLPLDTAKQMVGAMAHPLNKAYFDKE
KGVVTKGYGIMQPRVDVNIESAVKSLFTRVFAGQGGIDPYTTTVSDVYQDAFGEGIFTGK
GIYDVDIFTTALDKTIPENSVLSHDLLEGSFLRTALVTDIELIDGYPAKYNSFMMRLHRW
TRGDWQLLPWILGKNPLSMLSRWKMIDNLRRSLVQPVLALIALLAVWLFRNSYREWLILA
LISLCSPVLNYFVQLLIAGNYKIYIAKRRTTIITGFKAILLQLGLLLTFLPYQAELMVNA
VSKSIFRVYITKKNLLEWVTAADMEMSLKNGVGSYYRRMWFCPVYGAVILLLSILYRQSF
VPVASLLFVLWVLSPWIAYYISVPTEKNRVVLDSAGVEEVRLLARRTWCYFDEFAGPEEN
YLPADNYQEEPYKGAAHRTSPTNIGLLLVSNLAARDMGYINTLDFLARIENTISTVEKMD
KWNGHLYNWYNTVTLEVLRPKFISTVDSGNFIGYLMVLHEGLSGLMESPIYDFSTIEGLF
DLLEICNSEIEGSKAYFDTELLKKLTDSDNIEESFKNLLPAVLKLVDELDKSKRTGYWFK
KLDSNINTFNSEYTKYRGILFAPLKNVPQELKRIQQLQTKVQQLIDAMEFKYLFDPARNL
FTIGFDVEDGHASKSYYDLFASEARQTSLVAIARGEAGRQHWFKLGRKLVRVNGMKGLAS
WTGTMFEYLMPRLLIKSYSNTLIDKTYEFVVKTQIKYGLANKAPWGISESCYYAFDIGLN
YQYRAFGVPHLGLKRGLANDFVAAPYATVMALDIAPQECLENIHRFKEIGAFGNFGLYEA
VDFTNSRISKDQSYAVVKCYMVHHQGMSMLALVNFFKNNIMQERFHGNPLIKAVDSLLQE
KFPAAAMITKEYREQPVGGMRKNVNHKDTVIREYNKLSPYPGIHLLSNGNYYLMITDKGS
GYAKYHSMAVYRWINDYMQSSGAFIYIRNLNSNEFWSTTYNPTNTKPEAYKVIFAPHKAE
FVRREGNIETNTEVIISSEDNTEVRRVSIHNHSSSKRIIELTSYMEVVLTQHEADSAHPA
FSKLFVKTEYVDEYNGLLAMRRKRDDIKQTSWGYHIASTNGKAYGHVEYETDRSLFIGRN
RNLAYPRAMEPDRPLSNSVGSVIDPVFSLRIRVTVEPGESTIVNFCMGACDNRKTAVEML
AKYSDPAAADRVIDMAWTRSIVEEGFINVDADEEKAYIKLLPRLIFGIDRREQAEYILSN
SLSQSDLWPFGISGDLPIVLVTVKSRDSFEEIDWALKLHDFYRIKGVVFDLVILLTDEES
YIQPIFEMIRDMAVSGRSYELLDKRGGIFIRNSRQMKVEQKNLLFASAKIILDADEGIPS
LMEIIEGIEKSMDVEIHTPLEPSEESSAPSLVSESEYSGKDVVTAAELLFFNGFGGFTKD
GREYVIQLSDGMSTPAPWVNVIANERFGFICTESGGGYIWHLNSSQNKLTSWINDPITDT
PSEIIYICNTQNGKVWSCTPLPVREAEPYTIRHGFGYTCFGHKSNGINQTLTQFAATEAA
VKFSILKLENITTSEMLLETAYYFRPLLGTEFPQTSPYIVTEFDETSNAIIIDNVYSADF
RGLRAFLACSESGVSYTGSRLKFFGPGMEISNPAGMREELDSITGAGIDACAALKASIRL
RPGETKEILFIVGQEKSEKVTEVISAFRNIENAKNEMEKVKDSWNRRLGQIQVKTPDDSI
NLMLNGWLQYQVLSCRIWARTGFYQAGGAFGFRDQLQDVMAVVYSLPELTKNQILLHCRH
QFVEGDVQHWWHNQKMNGIRTRYSDDLLWLPYVTCDYINATGDFEILNLEERYITSPTLN
ENEHERYEVPSDSGLKGTVYDHCIRAIDKGLKFGIHGIPLMGGGDWNDGMNLVGVQGKGE
SIWLGWFMYCVLLRMIPICNKMGDVERAENYKTKADAIIEAIEREAWDGSWYRRAYFDDG
TPLGSMENDECKIDSLSQSWAAITGAAKNSRVEEAMSAVEKYLVDRRNGLIKLLTPPFYD
SELNPGYIKGYLPGVRENGGQYTHAATWVVYAFCKLGDGERAWELFSMINPVNHARTKSE
SMTYKVEPYVMAADVYAVYPNEGRGGWTWYTGAAGWMYRIGIDHLLGIKKQGNSILLNPC
IPQNMNEYSVRYVYGSSVYNITVKNPGHKNTTVERITIDGKTTETNRIELIDDGRTHEVE
AVM
Download sequence
Identical sequences B8I6R3
gi|220929976|ref|YP_002506885.1| WP_015925992.1.84728 394503.Ccel_2577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]