SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930185|ref|YP_002507094.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930185|ref|YP_002507094.1|
Domain Number 1 Region: 18-228,782-815
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.73e-20
Family Type II chitinase 0.023
Further Details:      
 
Weak hits

Sequence:  gi|220930185|ref|YP_002507094.1|
Domain Number - Region: 343-440
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00139
Family Family 6 carbohydrate binding module, CBM6 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220930185|ref|YP_002507094.1|
Sequence length 822
Comment hypothetical protein Ccel_2820 [Clostridium cellulolyticum H10]
Sequence
MKDYIKGKRCMVWSFMGNARMYQALNDYGDRLDTVGIFTFEVDITGTITETGTSVSSLTP
YRIKWPHIKWLLTIMNHGTESIFTALRNNEGGAKSKFLSEIVRIMNKYPWCAGVDIDLER
GGGFENRTAANALFADIYTTVKNYDSSKLVNICLPGMTGVQGSVGGENWCVYADLNDYCD
TAAIMSYGMAWAGSAPGPVSPRSWLEGIYNYAVTAMSPQKVYMGLPGYGWNWQIYDYPSN
LGKAYRGTSNTYYAAKNWMTGVYNFTNDQPPQPFIPIIAYWDDHDKVPWALPHVYDYMEG
WDAVSREPPIIDETYNRRKYLTCYGKTQKSEFGTIYVNRNGEPDSYTDGVVVGNGMITLS
SSEGKSEYNFTIAQSGTYDVVVQLCFPFWDKNGITIALDGTVVSYSENRLWWPYWRKTFW
AELATNVNLLAGTHSIKIEGGVVGTQFYGFRVCSNFSEYPSAGEATFCLSPRSFKDIDGN
MAVPDKGFKLTTEVLRRKPDSALAWYEDFRDPIILPESYWQMLSGSWSVWQNPDDNGNRP
YSQLEGSGQLAWKYDSFSDVHIRARIAFPMGSSGRAGVFCGNVFCCINIDTQQVELYQGS
TLLGSYAASYSKTPDADIRTNPNMYLIEMRKRGNRVRVYSGNSNTLRFTANISSTGGYCG
IQSDGQIKCELLRLGDAWTYEPYEAFDVTMPDGSLMQYGRIARSGVTWDNRFHVFTLTAD
VEESSTRSEDISMDYDFYHSNLLQIPCNADYTAKVIPRDINVWISRLFLGDADGFSILYY
QDVDSLVYWSNEAAYRWDLRGIAIWSLGQEDMRLWEALPKQI
Download sequence
Identical sequences B8I7P3
394503.Ccel_2820 gi|220930185|ref|YP_002507094.1| WP_015926185.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]