SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930557|ref|YP_002507466.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930557|ref|YP_002507466.1|
Domain Number 1 Region: 127-154,183-544
Classification Level Classification E-value
Superfamily Subtilisin-like 1.96e-41
Family Subtilases 0.00088
Further Details:      
 
Domain Number 2 Region: 539-629
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000646
Family Proprotein convertase P-domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220930557|ref|YP_002507466.1|
Sequence length 632
Comment peptidase S8/S53 subtilisin kexin sedolisin [Clostridium cellulolyticum H10]
Sequence
MSGFKKFLVIPFILIFLAVYPLTSYVESAETDSAPYSLTEITKLQIIKEVNGVKLAKAIF
NNQDIKDIVIFKDGSIEEYSKEKHGKLFEKDKLSKKLKEKIKKSSSDEEIPVAVHINDID
HNEVEKYVKDKLKIKDIKDEKPEKIKEYIKEKRIKSKEEYKKSNSQFVKEYINNEEELFE
SQYSPLIIIRLTNMDIEKLSKNMQVQEMDLFVDSTKEEDTYNSIPNINSKYVKDNLNLRG
DGVPIGILEVGYPNLDNTQLTDSNIIFDVPESTANRRRSTHATIVTSIIVGQTEGIAPGA
TAYVATASSRLGDYEKIEWLIDQGVYVINYSAGYSDVRGEYTDMAKWIDHISIQHDVIFV
KSSGNKRLDNLGISDPGMAYNAFTVGSMNDNDSINEPNWLDDIFSPFSCYTENENSENPY
PFKPDLTAPGESVDVAGYLSQAGTSISAPHVTGVLAQMLGAFPNIFPRNSVMKAVTTAAT
LHKTTDDYGIYSMSPSLSDKEGAGVIDALSIYNCLSGSHFLTENLTESQFPYIHNIGVNA
DDTQSVRVSLSWLKNNIIPDSSQNVVERELSDLDLEVFDPEGNQVGYSMSANNNLEVVEF
TPTMSGEYKIMVEGYALTNDSEQISLAWTESN
Download sequence
Identical sequences B8I0G0
gi|220930557|ref|YP_002507466.1| 394503.Ccel_3196 WP_015926544.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]