SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930603|ref|YP_002507512.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220930603|ref|YP_002507512.1|
Domain Number 1 Region: 280-746
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.25e-113
Family Glycosyltransferase family 36 C-terminal domain 0.000000294
Further Details:      
 
Domain Number 2 Region: 13-273
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.02e-41
Family Glycosyltransferase family 36 N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220930603|ref|YP_002507512.1|
Sequence length 749
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MSKKNQTHVVDNLWCIEENRFNQDTNKHFEGLFTQGNGYMHVRGSFEEGLRGAAQDEEYM
RMPANVTLEQPRHTKSKWGTFIPGIVGKHPLLKEEIINLPYFLGIDLIIADEELNMEAST
IREYKRWLDLRDGCLYRSLIWETEQGIDLKLCYKRFVSMEEKHLCLQQVQIEVLSGEGIL
DIRCGINPEVRTNGFNHFKEVLTEDNNSEYICTKTITDGGNSVLMLSGISASENICWSRL
TQNQRIFFSGSRLLKAGDCLEIQKVTSVVTDRDLEEGTLIERGEKYLKYFFKEGWEKIYE
RHSRAWDSKWLYSDIEITGDDEAQLAIRTYIYHLIRANSENDSRVAICAKGYAGEAYFGH
YFWDTEINMLPFFIHTNPQAARNLLMYRYNTLEGARKNALENGYEGAKYAWEASVTGEEQ
CPCWQYADHEIHITADIIYAMYHYVNSTEDIAFVRNFGVDMMVETARYWVQRVDRNKDGY
YELLGVMGPDEYLPITRNNAFTNRMVKFSLEKTADLLQKIKQEDAKGYLEIENRLGLKEL
EIEKIKEVAEKLILPYDENTDIVPQSEDFESYADVDFNAIWKDRTKPFGNFISQEKNYRS
KALKQADVLELMLLYPDDFTREQLTNAYDYYEPITTHDSSLSASVHGIVAAWMGRMPEAE
KFLKKVMDIDMSEEKKGAAEGIHIANCGGLWQMIVYGFAGLKSAMWCDEIQLAPHLPDKW
TKLEFTLAWHGKRYRITVTKEKHEITELY
Download sequence
Identical sequences B8I0X6
394503.Ccel_3243 WP_015926590.1.84728 gi|220930603|ref|YP_002507512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]