SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220930765|ref|YP_002507674.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|220930765|ref|YP_002507674.1|
Domain Number - Region: 590-722
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00935
Family Chondroitin ABC lyase I, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220930765|ref|YP_002507674.1|
Sequence length 952
Comment hypothetical protein Ccel_3406 [Clostridium cellulolyticum H10]
Sequence
MKKYIRKSFALLVILATLLTSFSGVSAAQQLISQTVEKQTITSGVTLESYDRFTTSGWIK
SYVLRVDLSNKNVKVDTLVNKKSVVGYSTVLNLAKNSGAIAAVNGSFFDFGPSGSGKGYT
YGPVVSSGEIDLAATRDSKDTATFSLNDVNEALFTYWNTKVELVTPKGERKVAASYNRYN
GKFNGMSIVDSKWGAKTPGATSNYPYWIEMVVEDGIVKEFNENKPSMDMPKNGFVVLGAG
SHIQYLKDNFNVGDPVEYNITMNVDTNNMKMALTGGAMLVKDDKVLTSFSHNPVSPSTRA
SRTAIGTSKDGKTLIVAAVDGRSSASIGMTQSELASYMHELGCANALNLDGGGSTTLVAR
KQGTTGLSVQNRPSDGSQRGVGASLGIFSVGPQGPVDSLYITSYEDYVFVNTSRAFTARG
MDKYMNPVNINPKDIKWSVSGVKGTFKGNVLYPTTAGEAVVTAKIGDNVVGTCPITVLES
PSKLEMNYDTLNVNPGSSITFSVKGWDKNGYTASIPPANIKWSTGGNVGNVSSSNVFTAN
KSGGTGYVAATVGSAVVSCPVSIRKSGLTKVIQDFNSTGIKLITSPNSAKASYSMASNVY
KSAKNSAKITYDFSKDVNVNRTAYLTLPNGGYTLESSTSKLGMWVYSSAKKPIWIGATVH
DSKGNYSSEYFAKGITWTGWKYLEVSLDNLNTPKKITNVFAVQPKSGKSSGTVYFDDLTM
VYTGYPAVDMTKVPKTTVPKDDNYKESTVSGTDSMTFSVFGQSTAYSSSNKTQIDMLNTL
ASRINSSVDVSVLVGSNDGLTRSSIKIPQLATTASYKSLDINGNRLIQLNTSKGGIRATN
TNEWLWLNNQLKTFDGKNLFVFLMEDPIKFNDTKEGQLLKDTLSNYQKETGKNVWVFYKG
NSNSSYMDKGVKYVVTAGFDSYGFSDSNKSAAKYAVVKVKGTSITYQFKSFN
Download sequence
Identical sequences B8I1Q9
394503.Ccel_3406 WP_015926746.1.84728 gi|220930765|ref|YP_002507674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]