SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220927883|ref|YP_002504792.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220927883|ref|YP_002504792.1|
Domain Number 1 Region: 617-703
Classification Level Classification E-value
Superfamily PKD domain 1.7e-23
Family PKD domain 0.0019
Further Details:      
 
Domain Number 2 Region: 64-101,181-315,342-422
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000000036
Family beta-glycanases 0.04
Further Details:      
 
Domain Number 3 Region: 547-612
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000837
Family Type I dockerin domain 0.00081
Further Details:      
 
Domain Number 4 Region: 443-540
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000767
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.031
Further Details:      
 
Weak hits

Sequence:  gi|220927883|ref|YP_002504792.1|
Domain Number - Region: 710-859
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000145
Family CBM4/9 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220927883|ref|YP_002504792.1|
Sequence length 861
Comment PKD domain-containing protein [Clostridium cellulolyticum H10]
Sequence
MAKVTKMRKVGALVVGSALLFTTMVPTSIFSAAASDAINVSIDTTAERAAISPYIYGGNW
EFNNAKLTAKRFGGNRTTGYNWENNYSNAGSDWQQSSDTYMLTSNKIPEDKWSEPGVVIT
DFHDKNLAAGEPYSLVTLQAAGYVSADANGTVAEDEVAPSERWKEVKFKKDAPLSLTPDT
TDNYVYMDELVNLLVNKYGSASTATGIKGYAIDNEPALWSGTHPRMHPNNATCAEVIDKN
INLAKTVKGVDPSAETFGLVAYGFAAYNDFQSATDWKDLKGNYTWFLDYYLDSMKKASTE
AGTRLIDALDLHWYPEAKGGGQRICFGEDPTNILCNKARLQAARTLWDPTYKEDSWIAQW
CSFGLPLIPKVQESIDKYNPGTKLAFTEYSYGADNHITGGIAEADVLGVFGKYGVYLATV
WGGGSYTAAGVNIYTNYDGNGSKYGDTKVKAETSDVENSSVYASVDSKDDSKLHVILINK
NYDSPMTVNFGINSDKQYTSGRVWSFDRSSANITEKDAIDAISGNKLTYTIPALTVCHIV
LDSSAQTTLYGDANHDETVDAIDYAYFKKILLNPDSEYDKTCDLNLDNAVDAVDFGILKQ
YLLGKIQSLPYKTITENKPPVAAFTVSPKEAFTGDNINFDATASTDPDGNVHIYSWDFGD
GTEGSGANITHKYKAPGTYTIKLTAFDEKGLSNSVTDTVTITSATGDNADVNFEDGELNG
FITNDATITTLSVTSDKAFQGNKSLKWDAVGSKDGKVDAEINSSVHVLKPGQTMTFRIWI
PEGAPIKSIQPYYMPHNADWTAAEWNSSWKGYDMVKKGDWNEFTVTLPLTTDVTLTECQF
GIQVETSAEGNFTMYVDSIDW
Download sequence
Identical sequences B8I5Z5
WP_012634874.1.84728 gi|220927883|ref|YP_002504792.1| 394503.Ccel_0429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]