SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928185|ref|YP_002505094.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928185|ref|YP_002505094.1|
Domain Number 1 Region: 36-75,106-519
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 2.27e-135
Family Cellulases catalytic domain 0.0000000269
Further Details:      
 
Domain Number 2 Region: 537-693
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.04e-40
Family Cellulose-binding domain family III 0.00012
Further Details:      
 
Domain Number 3 Region: 701-757
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000523
Family Type I dockerin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928185|ref|YP_002505094.1|
Sequence length 757
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MNFKKYVRKTTAFATAMAVVSSVFLGSSVYAGSTTPPFNYAEAFQKSLYFYDAEKCGPGV
TGGKLEWRGDCHVEDCELPLIPMKDYVGTNMSQAFIDKNKAFLDPDGNGSLDLHGGFHDA
GDHVKFGLPQGYTISTLGWGFYEFKDSFTQINEEDHIRDILKWGNDYFLRSTFMDNKGEV
VAFCFQVGDGTVDHAWWQPPELNKKSEVPRPAFFATSETPASDQCGEAAASLAINYLNFK
DSDPAYAKKCLDTAKALYRFAVKNRGLGDSGGFYGSAYDEDELSWAAVWLNIATGEQSYI
NDITAISDGKYTGYMGKIIKSTQDNWQNIWVHSWDVVWGGVFAKLAPITNDPMHWYLFRW
NLEYWSGIPHENPTDQTFMAATPGGFKVVNTWGSARYNAAAQLCAVVYTKYTDNMDVTEW
AKSQMDYILGDNPMKRSYEVGFSEISAKHPHHRAAHGSKTLSMNDPLEHRHTLWGALVGG
PDATDNHNDETTDFVSNEVAVDYNAGFVGALAGLYKYYGEGMKPLENFPPKEPAADDFYA
ESKLEQENTERTQVTVRIHNETSRPPEFVDELKARYFFDISEMLAAGQTIDDLTVAVMYD
EGKASDGKETAINGPFAWDAEKGIYYVEIDWTGNAFYGDKEFHFGLVEGLDSNWKSHWDP
TNDWSRKNIEKEYSINQNISVYRGDVKVYGNEPPKGNVGTKLGDLNGDGSVDALDYAIMK
KYILLPTGEVDLNTWDMNQDGEINALDLALLKKTLLG
Download sequence
Identical sequences B8I7V7
gi|220928185|ref|YP_002505094.1| 394503.Ccel_0735 WP_015924281.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]