SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928199|ref|YP_002505108.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928199|ref|YP_002505108.1|
Domain Number 1 Region: 29-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.66e-85
Family Xylanase/endoglucanase 11/12 0.0000000676
Further Details:      
 
Domain Number 2 Region: 232-298
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.71e-16
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928199|ref|YP_002505108.1|
Sequence length 298
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKKIMRALTLGLSIVCCTFALNVQAATTITENKTGTIDGYDYELWKDNGTTSMTLNGGG
KFSCSWSNINNALFRTGKKYNETQTHQQLGTISLDYACNYQPSGNSYLSVYGWTSSPLVE
YYIIESWGNWRPPGAQSKGTITVDGATYDVYETTRVNQPSIKGTATFQQYWSVRTSKRTI
GTISVSEHFKAWEKMGMTMGKMYEVSLVVEGYQSSGRADVTTMSINVGSQPPPVTKGDLN
ADGSINALDIAALKSHLIGATKLSGTALSNADVNGDGQVDALDFATMKKFLLGMISKF
Download sequence
Identical sequences B8I7X1
WP_015924295.1.84728 394503.Ccel_0750 gi|220928199|ref|YP_002505108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]