SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928287|ref|YP_002505196.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928287|ref|YP_002505196.1|
Domain Number 1 Region: 1-327
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.47e-72
Family beta-glycanases 0.00011
Further Details:      
 
Domain Number 2 Region: 358-518
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-32
Family CBM11 0.00000347
Further Details:      
 
Domain Number 3 Region: 527-583
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000123
Family Type I dockerin domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220928287|ref|YP_002505196.1|
Sequence length 584
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKILALIISCSIIMSFLPMSVYGAINSQDMVKKMGIGMNLGNTFDAPTEGSWSKAAQEY
YFDDFKQAGFKHVRIPIRWDQHTLANSPYTVDSNFLNRIETVIDWSLSRGFVTVINSHHD
TWLMDNYSQNIGRFEKIWEQIAQRFKGKSENLVFEILNEPHGNITDSQINDMNKRILNII
RKTNPTRNVIIGAGYWNSYNSLSQLEIPNDPNLIATFHYYDPYSFTHQWQGTWGTKNDMD
AIAMVFNHVKKWSDKNNIPVYLGEYGVMGHSDRTSAVKWFDFVSDQAISHGFSCGAWDNG
VFGSVDNDMAFYNRDTRQFDKEILNAILTTGTTYDWTPPTETNPDPPRTPATPAYGEQLI
EDFEGAMQWAAYSGVDATASCKISSGKSNNGLEITYAGSSNGYWGVVDNEHRNQDWEKWQ
KISFDIKSSNTNEVRLLIAEQSKIEGEDGEHWTYVIKPSTSWTTIEIPFSSFTKRMDYQP
PAQDGSETFDLYKVGSLHFMYSNSNSGTLNIDNIKLIGLPEEQIGGKIGDVNEDGNIDAI
DFALLKKYLLDSSISINKVNADINLDGDINAIDFAKLKMMLLGD
Download sequence
Identical sequences P25472
gi|220928287|ref|YP_002505196.1| WP_015924376.1.84728 394503.Ccel_0840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]