SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928660|ref|YP_002505569.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928660|ref|YP_002505569.1|
Domain Number 1 Region: 35-308
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.36e-60
Family alpha-L-arabinanase-like 0.0000687
Further Details:      
 
Domain Number 2 Region: 342-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-45
Family Beta-D-xylosidase C-terminal domain-like 0.0057
Further Details:      
 
Domain Number 3 Region: 545-676
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-36
Family Family 6 carbohydrate binding module, CBM6 0.00025
Further Details:      
 
Domain Number 4 Region: 683-745
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.55e-16
Family Type I dockerin domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928660|ref|YP_002505569.1|
Sequence length 746
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MQFKKVFSILLLVCLLVTQTTIVGAWQSDNDNGTYTNPILNADYPDIYAIRVGSDYYMVS
STFVSFPSIPILHSKDLINWEIIGYVSSDLNGTGKSYNLTNTFDDYGHGCWAPSIAYRNG
TYYVGIYQAQGKFIMCTATNPAGPYTKTVYNQGFHDPALFIDDDGTGYIVSEANDVKVTK
LSADYKSVVNSQVTTRIEGATGNYLVEGTHVMKKNGYYYIFRNSTPPESYTYCLRSKSIY
GPYEMRILLNGPSISGGSQIHQGGPIDTTTGEWWFYVFQDGQGLGRRDILIPMQWQNDWP
ILGDPSTVKNVSIAGKTYPMGTVPVTYKKPDVGATYPILTIPNSDEFSSTTMGVQWQWNH
YPDNTKWSLSERPGYLRLHAKNANNLWRATNTLTQRVEGPDCQGTIELDTTNMLDGDNAG
LCLLNIPYGTIGVSKSGGVKRIVANINAKKDTAGTITNGPTLTGNTVYLRAKADLISNKA
TFFYSTDNVNFTQLGGTLSMPFDLGFFQGDKFGIFNYTTASSGGYADINWFRYYTSAGPN
TPIPDITLSAFEKIEAESYNSQSGIQNVTCDEGTEAVGYTENGDYVVYKNVDFGSGANGF
NARVSSATVGGTIEIRLDSANGTLIGSCPVAGTGGWQAFTDANCTVSGVSGKHDLYLKFT
GESGYLFNINWFKFSNTSVISDKLGDVNSDGQIDAIDLQLIKKYILGLGEIENIKTADLD
GNGDVNAIDFSLMKQYLLGLITEFPG
Download sequence
Identical sequences B8I0L4
394503.Ccel_1233 WP_015924738.1.84728 gi|220928660|ref|YP_002505569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]