SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928665|ref|YP_002505574.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928665|ref|YP_002505574.1|
Domain Number 1 Region: 922-1050
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-37
Family Family 6 carbohydrate binding module, CBM6 0.00014
Further Details:      
 
Domain Number 2 Region: 51-384
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.45e-25
Family beta-glycanases 0.048
Further Details:      
 
Domain Number 3 Region: 1056-1119
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000559
Family Type I dockerin domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|220928665|ref|YP_002505574.1|
Domain Number - Region: 704-771
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00222
Family Glycosyl hydrolases family 16 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220928665|ref|YP_002505574.1|
Sequence length 1122
Comment family 6 carbohydrate binding protein [Clostridium cellulolyticum H10]
Sequence
MKRKILSVLLLVTMTTALFSATPMNTASAASTDFVLDGNNIKAGNINGLTFKGFGVLSGN
SSSALLMDYKSEHPEKYTELLQILFGGKNPIMTHVKIEMGNDRNNSTGPDPSTMRWENET
ANVKRHPGFQLAADAKKVNPNLKVSILRWNAPGWANSNDKIYTWYKNTILAAYRQYGYMI
DYVNPGVNEQTPNLTWTKQYAQRIKTDSTGFNNAEERALYNNIKVVISDEVSVGSFGDDM
VSDSTLRDAVSVAAYHYNTDDNSLGSFKQLAESFDKEVWNSEAQATFSNSSFRPNNNMKD
PTVAGTGIGGTNGPLEMGNTVIKGFVNSRRTHFIYQPVIGSFYEGGQYSFKELVSARDPW
SGWIHYDAGLVILRHFSWFSKAGWENESNTAGVWRAVPQASFTGATGTNPVNGRNGTPSY
MTLASPDKHDFSTIFINDSEYSKTYTFKTINMAYSGNPSLEVWETRAADKGASFNSNYMK
YTGTVSTNSSGVYTVNVKPYSIVTVTTLSNSGKAEFNTPLPVEGDRPVLDTDKTGSMQDT
RDNILYADNFDYSSKTAPVIAEGGQITGTQSYIDSRGGSKSAIPRYASDRNGAFEVYLPD
GSSNYILRQQVNQSSMGLGGTWNNGNPITGIGDNRWMNYKASVDVSFEHNSTEGGNNYAA
IGARQQGGENSHYLNGTPYILKFWFDGGWSLLVNGSSVANGNVASGSGGVKISGFNTAYN
AWHNISIMVADNKVTAYLDNTILYTYTDTTQRLSGRIDLASGYYNTCFDNLKVETIDGYA
PYYSEMLDNLEMYDLSSVSATKLVYGGSWAHENGKSMYNYQRSLSTSQGIGATIQYSFTG
TGLDILGANNGSAKLEVTVDGRVVNSSVGTMVSGNLHQNFTLHGLEYGKHTVCLKVLSGT
MVVDAVGVVANIAGASEIPVEQSAYSRIEAESYSNQSGIQTETCSEGGEDVGFVENGDYT
VYNNVDFGDGVGGFQARVASATSGGNIEIRLDSSTGTLIGTCPVAGTGDWQTYTDAKCTV
SGVTGKHDVYLVFKGDSGYLFNLNWFTFSEKTVIGNLGDINSDGQVDAIDLQVLKKYLLQ
LGEIGDTKLADLDANGEINAIDFSLLKQFLLGTIISFPGEAL
Download sequence
Identical sequences Q0PRN1
WP_015924743.1.84728 394503.Ccel_1238 gi|220928665|ref|YP_002505574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]