SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220928673|ref|YP_002505582.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220928673|ref|YP_002505582.1|
Domain Number 1 Region: 31-335
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.28e-70
Family Pectin methylesterase 0.0000082
Further Details:      
 
Domain Number 2 Region: 497-551
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000053
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220928673|ref|YP_002505582.1|
Sequence length 560
Comment pectinesterase [Clostridium cellulolyticum H10]
Sequence
MKRERFFQLALIFVFVFQTIVGSFLMSKVGAVSYDLIVAKDGSGNYTTVQAAINSAPSNS
QTRTKIYIKNGTYKEKINISSSKINISLIGQSKAGTILTYNDAASTKTSSGGTLGTTGSA
SVTIAGNGFQAENITFENSYDEKAYGNSQAVAVLAKADKMIFKGCSFKGNQDTLYANGDA
RRQYYYNCYIEGDVDFIFGSANAVFDSCEIFSLNRSGGCITAPSTKANQKGYLIYKCKLT
SSSSPKTIYLGRPWIPSSDTVQTTPKVLYRECELGSHITDTGWTVMSGNDPANFEMWEYN
NTGTGANTYRKQLPSVKAADYTIEKFLSGSDGWNPNIDSNTPVPIPDGQYIKSLVINDTV
NAVNWSVQSNLQVGDIIYGDRTYKFTQVPQKLLGSEWIKTACNSKIYTSDLASFTAKSDV
TVYIGLDTRVTSIPGWLSSWTDTGESLVSDNSSVAYNIYKKDFMAYSLVTLGTNGASSST
VNYAVIVKSNTYDFLLGDANGDGEVNSLDYATLKSYLLGKISLSQEAMKTVDFNNDNTID
AIDLALFRINLLGGPIYNML
Download sequence
Identical sequences B8I0M7
WP_015924751.1.84728 gi|220928673|ref|YP_002505582.1| 394503.Ccel_1246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]