SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929020|ref|YP_002505929.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929020|ref|YP_002505929.1|
Domain Number 1 Region: 32-304
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.03e-101
Family Amylase, catalytic domain 0.0000000606
Further Details:      
 
Domain Number 2 Region: 299-394
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.53e-26
Family alpha-Amylases, C-terminal beta-sheet domain 0.0023
Further Details:      
 
Domain Number 3 Region: 402-470
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.93e-16
Family Type I dockerin domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|220929020|ref|YP_002505929.1|
Sequence length 471
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKIKRLIALVILTAVFISPFPPTVQNGNQVLALNNSLGLTPPMGWNSWNIFGGDINEEK
IKQITDAMVTTGMKDAGYEYVNIDDNWMANPARDANGILIPDPKRFPNGMKALADYIHSK
GLKFGIYGDRGVTTCCNIPQSGSQGYEEQDAKTFAQWGVDYLKYDNCASDSNLQAGYEKM
RDALLKTGRPIFYSICCWYFAGAWMVDCGNSWRTTGDISDNWRSIIKNIDENSKSAAYAG
PGHWNDPDMLEVGNGNMTETEYKAHFSMWCMMAAPLIAGNDLRNMTPATKDILTNKEVIA
INQDAAGVQGTKVSTSGELEVWCKPLGTDGTTKAVALLNRGAASADITVNWRDIKLADGP
ATVRDLWEHKDYGKFNTEYTANVPSHGVVVLKVQASSTDTDIMYGDVDGSGMIDALDYSL
VKRYLLDQISDFPASNGKLTADVDGDSQITALDFSLIKQYLLGIVNKFPVQ
Download sequence
Identical sequences B8I2F6
394503.Ccel_1597 WP_015925065.1.84728 gi|220929020|ref|YP_002505929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]