SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929434|ref|YP_002506343.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929434|ref|YP_002506343.1|
Domain Number 1 Region: 31-228
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.44e-17
Family YxiM C-terminal domain-like 0.066
Further Details:      
 
Domain Number 2 Region: 237-302
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000432
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|220929434|ref|YP_002506343.1|
Sequence length 303
Comment G-D-S-L family lipolytic protein [Clostridium cellulolyticum H10]
Sequence
MKKLLLFSIIMAVMAASFTPATIFAATTQIKGSDVMIIGDSYFAMSGEITRALENEARNA
GVLGANDRFRDYTVSGSTLANNGIPSQYRNGINSGKVKYVIMDGGGNDCLQGYSAPPYTA
STPFIKNATDAVTDLLKQMKADGVVKVFYLFYPDPNGDLNGLKSKLDALRPIMQSTVANA
AQKPETYFFDIRPTWSGNLSQYTLPDGIHPTTAGSVATAKAMWAEMQKVNFFGTSTPTIK
YGDYNNDGSIDALDFSSFKMYLMNPVRTYTEVLDLNSDNTVDAIDFAIMKQYLLGIVKNL
PYK
Download sequence
Identical sequences B8I3M0
gi|220929434|ref|YP_002506343.1| 394503.Ccel_2017 WP_015925465.1.84728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]