SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|220929796|ref|YP_002506705.1| from Clostridium cellulolyticum H10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|220929796|ref|YP_002506705.1|
Domain Number 1 Region: 313-806
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.68e-131
Family Cellulases catalytic domain 0.000000000173
Further Details:      
 
Domain Number 2 Region: 37-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-30
Family CBM4/9 0.004
Further Details:      
 
Domain Number 3 Region: 214-310
Classification Level Classification E-value
Superfamily E set domains 7e-23
Family E-set domains of sugar-utilizing enzymes 0.00035
Further Details:      
 
Domain Number 4 Region: 817-872
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000942
Family Type I dockerin domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|220929796|ref|YP_002506705.1|
Sequence length 874
Comment glycoside hydrolase [Clostridium cellulolyticum H10]
Sequence
MKKRVLKKIAMLMVIVFVLSSCALQAFAVEYEGAGDLIRNHTFDNGVGFPWRVVESYPAT
ADYDITADGKYKITITKIGAAGIGQRWDVQFLHRGLSLVNGHTYTIKFTVTASRACKIYP
KIGDQGDPYEEYWNMNQQWQFLELQANVPKTVTATFIQTKGDKKNVEFAFHLAPDICTSE
AQNPASFQPITFTFDDIYVADPQFAGYPAPIPEPTNVVRLNQEGFYPNADKIATVVSSST
TPINWQLVNSAGTAVLTGKSTVKGADHASGDNVHIIDFSSYKTAGTGYKIVTDVPVTNIG
DNGSMPFNISNDIYSKMKYDSMKYFYHNRSGIPIKMPFCDQPQLARPAGHTNDILAPDPT
KDYRANYTLDVTGGWYDAGDFGKYVVKGGISTWTLMNSYERALYLGDTSVVPFIDGSLNI
PESGNGFPDILDEARYNLNTLLNMQVPTGNTLAGMVHYKAGDERWLQLAIRPDQDTMKRY
LQPPSTAATLNLAAIAAQGSRLWKQYDAAFATKCLTAAETAWDAAVEHPDKYIYINSVTG
IGTNGENYFLDDFYWAACELYATTGSNKYLNYINSSPHYLQEPSELTAGDMGFTGCFDLD
NTAGMGTITLALVPNGLPAADIAKAKANIQTAADKFISIEKAQGYGVPIEEKVISSRFDQ
STVSGFPCGSNSFVINEAIVMSYAYLFSNKNTKYINGAITAMDYILGRNPNVQSYVTGYG
DNPLENPHHRFWAYQADNSFPHPPAGCMSGGPNSGLQDSWVKSLGWQPGKVASEKCFLDN
IESWSTNEIAINWNAPLAWVSAFLDEEGRVICGGDTLGDINGDGQRDALDFALIKKALLN
GDTSIQNADVNNDGSVDAMDLALYKSFLLGKVNF
Download sequence
Identical sequences B8I5I9
WP_015925814.1.84728 394503.Ccel_2392 gi|220929796|ref|YP_002506705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]