SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118496732|ref|YP_897782.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118496732|ref|YP_897782.1|
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-24
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118496732|ref|YP_897782.1|
Sequence length 117
Comment ferredoxin [Francisella novicida U112]
Sequence
MTATLETKATNLGLDNIQKHIFLCCDQERQKCCAGDVSLKAWEYLKKRLQELGLSQNGHI
YRTKTYCLRICQNGPIAVVHPDNVWYHSCTPEVLEEIIQKHLIGGEIVKKYVFNKNS
Download sequence
Identical sequences A0A1J0L1L1 A0Q463
gi|385792041|ref|YP_005825017.1| gi|118496732|ref|YP_897782.1| WP_003032777.1.11577 WP_003032777.1.21561 WP_003032777.1.36632 WP_003032777.1.43725 WP_003032777.1.59804 WP_003032777.1.64199 WP_003032777.1.66025 WP_003032777.1.70888 WP_003032777.1.72761 WP_003032777.1.89268 WP_003032777.1.89309 WP_003032777.1.91892 WP_003032777.1.92567 401614.FTN_0117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]