SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497294|ref|YP_898344.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497294|ref|YP_898344.1|
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-49
Family Glutathione peroxidase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118497294|ref|YP_898344.1|
Sequence length 156
Comment glutathione peroxidase [Francisella novicida U112]
Sequence
MSIYDFKLTANDGSEYHLPKNKVLLIVNVASKCGFTKQYRGLQHLHKIYPDLEIVAFPCN
SFGGQEPGSDEEIKNFCETNYNVTFPIMKKTKVNGKDAEPLFEYLKERAKGVLGTEAIKW
NFTKFLVSKDGETVVRYAPKTIPEDLIPDIDNFLKD
Download sequence
Identical sequences A0A0B3VMJ4 A0A1I9Y8Y1 A0A1J0KY69 A0Q5S5 F4BK50
WP_003016618.1.100020 WP_003016618.1.100480 WP_003016618.1.100639 WP_003016618.1.11004 WP_003016618.1.11577 WP_003016618.1.12700 WP_003016618.1.12820 WP_003016618.1.13116 WP_003016618.1.1316 WP_003016618.1.13715 WP_003016618.1.13896 WP_003016618.1.1431 WP_003016618.1.15828 WP_003016618.1.17117 WP_003016618.1.18135 WP_003016618.1.19348 WP_003016618.1.21553 WP_003016618.1.21561 WP_003016618.1.2186 WP_003016618.1.24109 WP_003016618.1.24307 WP_003016618.1.2436 WP_003016618.1.25474 WP_003016618.1.27183 WP_003016618.1.27408 WP_003016618.1.28031 WP_003016618.1.28288 WP_003016618.1.30377 WP_003016618.1.31247 WP_003016618.1.3134 WP_003016618.1.31907 WP_003016618.1.33374 WP_003016618.1.34036 WP_003016618.1.35898 WP_003016618.1.36125 WP_003016618.1.36481 WP_003016618.1.36632 WP_003016618.1.37362 WP_003016618.1.37819 WP_003016618.1.38195 WP_003016618.1.38763 WP_003016618.1.3975 WP_003016618.1.40692 WP_003016618.1.41167 WP_003016618.1.43575 WP_003016618.1.43725 WP_003016618.1.43882 WP_003016618.1.44313 WP_003016618.1.44922 WP_003016618.1.45908 WP_003016618.1.46791 WP_003016618.1.46956 WP_003016618.1.47340 WP_003016618.1.48020 WP_003016618.1.48098 WP_003016618.1.48962 WP_003016618.1.50994 WP_003016618.1.51529 WP_003016618.1.5414 WP_003016618.1.54420 WP_003016618.1.5487 WP_003016618.1.54961 WP_003016618.1.55289 WP_003016618.1.57478 WP_003016618.1.59804 WP_003016618.1.59871 WP_003016618.1.5992 WP_003016618.1.60112 WP_003016618.1.60504 WP_003016618.1.63091 WP_003016618.1.63562 WP_003016618.1.64987 WP_003016618.1.65566 WP_003016618.1.66025 WP_003016618.1.6752 WP_003016618.1.68327 WP_003016618.1.69118 WP_003016618.1.69545 WP_003016618.1.69933 WP_003016618.1.70888 WP_003016618.1.7106 WP_003016618.1.72408 WP_003016618.1.72665 WP_003016618.1.72761 WP_003016618.1.73228 WP_003016618.1.73973 WP_003016618.1.74506 WP_003016618.1.74697 WP_003016618.1.76402 WP_003016618.1.77714 WP_003016618.1.77892 WP_003016618.1.78176 WP_003016618.1.78521 WP_003016618.1.80474 WP_003016618.1.80603 WP_003016618.1.82216 WP_003016618.1.8254 WP_003016618.1.83968 WP_003016618.1.84288 WP_003016618.1.84370 WP_003016618.1.85044 WP_003016618.1.85695 WP_003016618.1.85899 WP_003016618.1.87224 WP_003016618.1.87451 WP_003016618.1.88243 WP_003016618.1.89268 WP_003016618.1.89309 WP_003016618.1.90324 WP_003016618.1.91892 WP_003016618.1.92567 WP_003016618.1.93025 WP_003016618.1.93182 WP_003016618.1.95205 WP_003016618.1.95453 WP_003016618.1.95561 WP_003016618.1.95669 WP_003016618.1.9679 WP_003016618.1.96937 WP_003016618.1.97486 WP_003016618.1.99661 gi|385792637|ref|YP_005825613.1| gi|115315088|ref|YP_763811.1| gi|423051045|ref|YP_007009479.1| gi|156502835|ref|YP_001428900.1| gi|89256677|ref|YP_514039.1| gi|387824270|ref|YP_005823741.1| 119857.FTL_1383 393011.FTH_1345 401614.FTN_0698 441952.FTM_0749 458234.FTA_1469 gi|422939012|ref|YP_007012159.1| gi|118497294|ref|YP_898344.1| gi|187931517|ref|YP_001891501.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]