SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497340|ref|YP_898390.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497340|ref|YP_898390.1|
Domain Number 1 Region: 15-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000701
Family Glutathione S-transferase (GST), N-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 134-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000209
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118497340|ref|YP_898390.1|
Sequence length 235
Comment hypothetical protein FTN_0745 [Francisella novicida U112]
Sequence
MIHLHQLPKLKGRNYSCSPFCLKLELYLKVTNLNYQNHFNLEFNKSPTGKMPYIETMGKK
FADSNLIIEMLDKQNQVNLDQHLSIEQKAISTAFIRLCEDSLYWVGVYSRWADKDNYAWK
QEFLESTKLPKAMASIVYPVAKRNILRQLKAAGVTNLTNNEIYSKAERDLQAIADYLGEK
EYFFNSKLSLVDLVVFSFLINIADGSCGRRLQNFLVSLKLDNFIKNMQDSFNINF
Download sequence
Identical sequences A0Q5X1
WP_003038931.1.11577 WP_003038931.1.21561 WP_003038931.1.72761 401614.FTN_0745 gi|118497340|ref|YP_898390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]