SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497357|ref|YP_898407.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497357|ref|YP_898407.1|
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-16
Family Thioltransferase 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118497357|ref|YP_898407.1|
Sequence length 82
Comment glutaredoxin like protein [Francisella novicida U112]
Sequence
MNNFKSIVLYRMVTPEKICPYGLKAKALFEQKGWSFEDNHLKTRAETDAFKAKYNLQTTP
LIFIDGQQIGGYSDLLEFLGEK
Download sequence
Identical sequences A0A1I9Y945 A0A1J0KL77 A0Q5Y8
gi|385792697|ref|YP_005825673.1| 401614.FTN_0762 WP_003033610.1.11577 WP_003033610.1.21561 WP_003033610.1.36632 WP_003033610.1.43725 WP_003033610.1.59804 WP_003033610.1.64199 WP_003033610.1.66025 WP_003033610.1.70888 WP_003033610.1.72761 WP_003033610.1.76402 WP_003033610.1.89268 WP_003033610.1.89309 WP_003033610.1.91892 WP_003033610.1.92567 gi|118497357|ref|YP_898407.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]