SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497366|ref|YP_898416.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497366|ref|YP_898416.1|
Domain Number 1 Region: 150-318
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.13e-27
Family DsbC/DsbG C-terminal domain-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118497366|ref|YP_898416.1|
Sequence length 373
Comment protein-disulfide isomerase [Francisella novicida U112]
Sequence
MTKKKLLKALAVAAIATSLVACSDSSSNDKTSTTAASSGSSVATTTVAAPADNTNVTANA
SYTIGYGMGSSIATDKNIKTFNLNNDKVMAGFEDAINAKKPAIPLEDIANNMNTLRDKMQ
QQMNQKAVTSFLSVQDGIYNSDLTPKSDIKNPDVVVYEFFDYQCMYCSKLAPEIEKIMKD
NSDVQVVFAEFPIFGQKLPASEYAAEVGTAIYKLYGADAYVKYHNGIFATGEDEGSLKNA
TVDNVAKQAGADMTKVNKAIQDDKIADHLKDMLKMGFGQLGIQGTPFLVIAPAKNATVAN
TTIIGGYTTADGIQAAINKAKSTATTTSTSNNGQTDTKQAQNDIATVTAEAQATSGSTEQ
LAQQSQDDDSVEA
Download sequence
Identical sequences A0Q5Z7
gi|118497366|ref|YP_898416.1| 401614.FTN_0771 WP_003036264.1.11577 WP_003036264.1.21561 WP_003036264.1.59804 WP_003036264.1.72761 WP_003036264.1.91892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]