SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497448|ref|YP_898498.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497448|ref|YP_898498.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.02e-38
Family Thioltransferase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118497448|ref|YP_898498.1|
Sequence length 108
Comment thioredoxin [Francisella novicida U112]
Sequence
MALSNVIKTDEANFDKLIDNTNKAVLVDFYADWCGPCKTLAPILDQLSKDYTKAVIVKVN
VDENQNLAARFAIRSIPTLIVFKNGKQVETLMGVHTASQLEQKLKAYE
Download sequence
Identical sequences A0A1I9Y9F7 A0A1J0KZM9 A0A1S2WXF6 A0Q679
401614.FTN_0856 WP_003033759.1.11577 WP_003033759.1.21561 WP_003033759.1.36632 WP_003033759.1.43725 WP_003033759.1.59804 WP_003033759.1.64199 WP_003033759.1.69967 WP_003033759.1.70888 WP_003033759.1.72761 WP_003033759.1.76402 WP_003033759.1.89268 WP_003033759.1.89309 WP_003033759.1.91892 WP_003033759.1.92567 gi|118497448|ref|YP_898498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]