SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497550|ref|YP_898600.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497550|ref|YP_898600.1|
Domain Number 1 Region: 3-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.02e-37
Family Glutathione peroxidase-like 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118497550|ref|YP_898600.1|
Sequence length 174
Comment AhpC/TSA family protein [Francisella novicida U112]
Sequence
MTKKVPNVTFKTRVRDESIGGSNPFRWQDVTSADIFDNKRVIVFSLPGAFTPTCSTYQLP
GFENNAARFKELGIDEIYVLSVNDSFVMNKWIQVQGIQNIKPIPDGNGEFTEALDMLVDK
SNIGFGKRSWRYAMIVNNGEIEKMFVEPGKRDNADNDPYGESSPENLLKYLESK
Download sequence
Identical sequences A0A0B6EBY1 A0A0E2ZJK1 A0A0G2RML8 A0A1I9Y9R5 A0Q6I1 Q5NHA9
gi|385792924|ref|YP_005825900.1| WP_003023265.1.101979 WP_003023265.1.10388 WP_003023265.1.11577 WP_003023265.1.11695 WP_003023265.1.17073 WP_003023265.1.17471 WP_003023265.1.1833 WP_003023265.1.19035 WP_003023265.1.21561 WP_003023265.1.2301 WP_003023265.1.25812 WP_003023265.1.26192 WP_003023265.1.26690 WP_003023265.1.31410 WP_003023265.1.35965 WP_003023265.1.36081 WP_003023265.1.36632 WP_003023265.1.3831 WP_003023265.1.38368 WP_003023265.1.38474 WP_003023265.1.38662 WP_003023265.1.39861 WP_003023265.1.40634 WP_003023265.1.42944 WP_003023265.1.43725 WP_003023265.1.44744 WP_003023265.1.47286 WP_003023265.1.52816 WP_003023265.1.53326 WP_003023265.1.5563 WP_003023265.1.56738 WP_003023265.1.5829 WP_003023265.1.59625 WP_003023265.1.59804 WP_003023265.1.60146 WP_003023265.1.61154 WP_003023265.1.64199 WP_003023265.1.65967 WP_003023265.1.66025 WP_003023265.1.66077 WP_003023265.1.66092 WP_003023265.1.66463 WP_003023265.1.67317 WP_003023265.1.70888 WP_003023265.1.72761 WP_003023265.1.75261 WP_003023265.1.76402 WP_003023265.1.77053 WP_003023265.1.78037 WP_003023265.1.80616 WP_003023265.1.82545 WP_003023265.1.87851 WP_003023265.1.89268 WP_003023265.1.89309 WP_003023265.1.91892 WP_003023265.1.92567 WP_003023265.1.98147 YP_169583.1.84429 gi|118497550|ref|YP_898600.1| gi|56707687|ref|YP_169583.1| gi|379716941|ref|YP_005305277.1| gi|385794316|ref|YP_005830722.1| gi|110670158|ref|YP_666715.1| IDP01762 177416.FTT_0557 393115.FTF0557 401614.FTN_0958 418136.FTW_0983 gi|134301967|ref|YP_001121936.1| gi|379725545|ref|YP_005317731.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]