SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497565|ref|YP_898615.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497565|ref|YP_898615.1|
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.41e-63
Family Glutathione peroxidase-like 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118497565|ref|YP_898615.1|
Sequence length 199
Comment AhpC/TSA family peroxiredoxin [Francisella novicida U112]
Sequence
MVLVGKKAPLFNAPAVLGNGEIVDSYDFAKAIQGKYAVVVFYPLDFTFVCPSELIALDKR
TAKLKELGVEVVSVSIDSHFTHNAWRNTPINDGGIGPVKYTMVADINQEIVKAYDVQAAG
GMAFRGTFLIDKSGVVRHQVVNDLPLGRNMDEVIRMVEALQFHEEHGEVCPAGWKKGDQG
MKASPQGVAEYLSDHVIDL
Download sequence
Identical sequences A0A0B6KCS8 A0A1I9Y9S9 A0A1S2WT24 A0Q6J6
gi|118497565|ref|YP_898615.1| gi|385792939|ref|YP_005825915.1| WP_003033959.1.11577 WP_003033959.1.21561 WP_003033959.1.36632 WP_003033959.1.43725 WP_003033959.1.59804 WP_003033959.1.64199 WP_003033959.1.66025 WP_003033959.1.69967 WP_003033959.1.70888 WP_003033959.1.72761 WP_003033959.1.76402 WP_003033959.1.89268 WP_003033959.1.89309 WP_003033959.1.91892 WP_003033959.1.92567 401614.FTN_0973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]