SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497624|ref|YP_898674.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497624|ref|YP_898674.1|
Domain Number 1 Region: 77-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.11e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.002
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.78e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118497624|ref|YP_898674.1|
Sequence length 214
Comment glutaredoxin [Francisella novicida U112]
Sequence
MKIYLYHHCPYCIKVRLVADLSNFDYQMIILANDDEKAHIDRIGSKQVPFLEKDDGTFIK
ESDEICKFIAKVQNFEIAESTIDDFVKGCIADLEPHYRRIIYPRIPHHPRNECDFPTQSA
KEYFINKKSQYIGDFDALLRNPPYDSIRAINQILAKIDPFIKTLFINGEKFSWDDINIFP
IFFILTMSKDLLEIPTNITNYIKNIEAKTNIELY
Download sequence
Identical sequences A0Q6Q5
gi|118497624|ref|YP_898674.1| WP_011733672.1.11577 WP_011733672.1.21561 WP_011733672.1.72761 401614.FTN_1033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]