SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118497988|ref|YP_899038.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118497988|ref|YP_899038.1|
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.73e-39
Family Thioltransferase 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118497988|ref|YP_899038.1|
Sequence length 107
Comment thioredoxin [Francisella novicida U112]
Sequence
MSKCIDISDSQFESEVVNSDIPVLLDFWAPWCGPCKMLAPILDQVAEHYGDKIKVCKINI
DDNEETAMKFGVRGVPTLMVFKDGENKETKVGVVQKTQLISIVDKYL
Download sequence
Identical sequences A0A153JBY0 A0A1J0L045 A0A1S2WSW8 A0Q7R9
WP_003018147.1.11577 WP_003018147.1.21561 WP_003018147.1.26434 WP_003018147.1.36632 WP_003018147.1.37819 WP_003018147.1.43725 WP_003018147.1.45210 WP_003018147.1.50994 WP_003018147.1.5414 WP_003018147.1.64199 WP_003018147.1.69967 WP_003018147.1.70888 WP_003018147.1.72761 WP_003018147.1.80474 WP_003018147.1.82488 WP_003018147.1.89268 WP_003018147.1.89309 WP_003018147.1.92567 401614.FTN_1415 gi|118497988|ref|YP_899038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]