SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118498007|ref|YP_899057.1| from Francisella novicida U112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118498007|ref|YP_899057.1|
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-29
Family ArsC-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118498007|ref|YP_899057.1|
Sequence length 139
Comment arsenate reductase [Francisella novicida U112]
Sequence
MDYFYDFYTNVIYNCSYSKNIINVMKIYHNPKCSKSRQAKQILDQNNIDYEIHLYLDKPL
SKDQVIVLLQKLKLSIKDIIRTKENIWKENFSDKEFTEAELIEIVVANPGLLERPIIENG
DFAVVARSDEKIQQILNTY
Download sequence
Identical sequences A0Q7T8
gi|118498007|ref|YP_899057.1| 401614.FTN_1435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]