SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134298080|ref|YP_001111576.1| from Desulfotomaculum reducens MI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134298080|ref|YP_001111576.1|
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 1.44e-44
Family N-utilization substance G protein NusG, N-terminal domain 0.0000278
Further Details:      
 
Domain Number 2 Region: 118-174
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 7.22e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134298080|ref|YP_001111576.1|
Sequence length 175
Comment NusG antitermination factor [Desulfotomaculum reducens MI-1]
Sequence
MSKQWYVVHTYSGYENKVKANLERRIESMNMEDKIFRILVPMEDEVEIKNGKKKVSKKKV
FPGYVLVEMIMTDDSWYVVRNTPGVTGFVGTGSKPIPLDEEEAKTIIKQMGIEEPKAKID
VVLGENVKVTDGPFENFVGVIEEIYPDKGKVKVMVSMFGRETPIELDFTQIEKLS
Download sequence
Identical sequences A4J0Z8
349161.Dred_0202 WP_011876592.1.64742 gi|134298080|ref|YP_001111576.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]