SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116492961|ref|YP_804696.1| from Pediococcus pentosaceus ATCC 25745

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116492961|ref|YP_804696.1|
Domain Number 1 Region: 274-445
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.57e-44
Family MgtE membrane domain-like 0.0000384
Further Details:      
 
Domain Number 2 Region: 134-269
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-33
Family CBS-domain pair 0.000012
Further Details:      
 
Domain Number 3 Region: 7-132
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 5.75e-26
Family MgtE N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116492961|ref|YP_804696.1|
Sequence length 449
Comment transcriptional regulator [Pediococcus pentosaceus ATCC 25745]
Sequence
MDNTQAIFEKLKIELLKHHSKKFKEDFLDLHNYDQGRFFGELTREERLLVYKYLDPDELA
DTFDELDDEPDLIAEYLDEMAPSYAAALLNGMYDDNEADILGAVRNDKLHKLLSYMQPVD
AARVRQLLKYEEKTAGALMTTEFISVAVDTTVGSAMNQVKQEAQYAETISYIYVVNESNQ
LIGVISVKDLIVNPDDVFIKRIMNTNVVSVRDDEDQTEIAAQIRDYNFIAIPVVDERNKM
LGIITVDDIIDVIDEESAQDYSRLAGVNSEDMSENPWKAVRSRIPWLVTMLFLGLISAMV
ISQFQNVLDKFGVLAVFITLITGTAGNAGTQSLAVAIRRLANDEEGDSVFKLILNEVITG
ILIGLLTGIAIFAVILFWQKNMVLGIIVGAAMSGAIFVANLVGTLIPIIMEKLGMDPVVA
SGPFISTLSDITSILIYFNIATICLANFY
Download sequence
Identical sequences Q03EW8
278197.PEPE_1200 WP_011673551.1.1876 gi|116492961|ref|YP_804696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]