SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465078|ref|YP_001040187.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465078|ref|YP_001040187.1|
Domain Number 1 Region: 175-496
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.3e-114
Family Leucine aminopeptidase, C-terminal domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 5-179
Classification Level Classification E-value
Superfamily Macro domain-like 1.06e-17
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465078|ref|YP_001040187.1|
Sequence length 501
Comment peptidase M17, leucyl aminopeptidase domain-containing protein [Staphylothermus marinus F1]
Sequence
MTKLKYSLSDKPLEKIDIDTLIVPVISENGKPKIPKEIRDVFQELIDIIIDSGDFRGEEK
EVTIVYGKGRIKRLVLAGLGKEPDLETFREAIASATNSIVEKQGVRAGLYLRDLKNVFKV
DDLIDNSVLTIEITLFDPGKLFKTESKKLNLREVVLIVDNITEDIEEALKRSAIISDAVN
YARRIAESPSSIMNPAKIEEEARKLAEQYGLKIKVFHKEDLEKMGMNGILAVGSGGGVPP
RLIILEYRGRNSNEWDYAFVGKTVTFDAGGLNLKPTGYIDNMKYDKSGGAVVLGIMKAVA
ELKLPVNIVAALPAVENMPGPNAYKPRDIIKMYNGLTVEVGNTDAEGRLILADALSYVDK
NYTPKQIFDLATLTGAIVIALGNYAAGLFTEDDDVAKKLYEIGWKIGERVWRMPLWKEYY
EQLKSNIADTNNIGGRPAGAITAAAFLSKFISDKKKWVHLDIAGVSWVEKGYPKKPYYKP
AATGFGVRLLTYYLLKNLEQL
Download sequence
Identical sequences A3DKW9
399550.Smar_0166 gi|126465078|ref|YP_001040187.1| WP_011838470.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]