SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465096|ref|YP_001040205.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465096|ref|YP_001040205.1|
Domain Number 1 Region: 68-153
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 1.18e-18
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 7-68
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000149
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465096|ref|YP_001040205.1|
Sequence length 154
Comment AsnC family transcriptional regulator [Staphylothermus marinus F1]
Sequence
MTRSSTILDDIDLKILDQLRKYSRTSFREIASKLNKPVSTIYDRIKRLEKHGIIRGFSID
IDYRKLGYQIKALILVNAEGKDLIKVEQDIASNPNVQAVYDITGEYDIALIASFKTIEEL
DAFVKKLLSKPGIKHTRTSIVFRTVKETQHLPLK
Download sequence
Identical sequences A3DKY7
WP_011838488.1.69113 399550.Smar_0184 gi|126465096|ref|YP_001040205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]