SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465130|ref|YP_001040239.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465130|ref|YP_001040239.1|
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.5e-38
Family GHMP Kinase, N-terminal domain 0.00046
Further Details:      
 
Domain Number 2 Region: 172-315
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.73e-32
Family Mevalonate kinase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465130|ref|YP_001040239.1|
Sequence length 324
Comment mevalonate kinase [Staphylothermus marinus F1]
Sequence
MICSAAPAKVILFGEHFVVKDKPAIVTAVNLYAKTCITELESEKHLLISKQLRLETDIDK
DRVPEQLAQFKHIYEIINDKYGITRGFKAFIDSDIPVSSGMGSSAATAVSFTYSLLRFLG
VEFELEDINNIAYEAEKLVHGKPSGIDNTVSTYGGIIYYKRGYMEKLNVKWPQNLSLVVV
DSGIKRNTGKVVMDVLERYERHKEIMKHIYDAAEQLVNKARNLILSGRFYDLGELISINQ
GLLESIGVSIYETDKIIYAMIENGALGAKISGAGRGGIVYGLFMENNLNKAIHKLKNIGY
KPIIVKPVEKGVIELQDSLMNIHY
Download sequence
Identical sequences A3DL21
399550.Smar_0218 gi|126465130|ref|YP_001040239.1| WP_011838522.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]