SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465306|ref|YP_001040415.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126465306|ref|YP_001040415.1|
Domain Number - Region: 105-153
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0221
Family ADP-ribosylating toxins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465306|ref|YP_001040415.1|
Sequence length 317
Comment triphosphoribosyl-dephospho-CoA protein [Staphylothermus marinus F1]
Sequence
MEKHWFYAELLSYSILLEVSGYPKPGNVHRTRNLPGLVFEDFLYTGVASVKWFKKGIIRG
LRGYSRIVFGDIIYGIVHDTISYRGVNTCLGSSLLLAPISIGIGKCLGKQVEDIKCYIEE
ALNALKKTTVYDSIYFYRAVRLAKPSYIRKTDDTGEYVNVWDRCFRSKLIARNQRLHDIL
KYSASRDIVADEVVNGYPRSLDGKMFFQARINAHKDWNRGVVETYLYLLSKYKDTTITRT
HGEKIAAEIVVRARKTLNTVLEKRNNWMNQVEDLDVYLRKQNINPGSIADIVVSTIALIL
LDKNLSYTIKHDKQLLK
Download sequence
Identical sequences A3DLJ7
399550.Smar_0395 gi|126465306|ref|YP_001040415.1| WP_011838698.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]