SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465380|ref|YP_001040489.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|126465380|ref|YP_001040489.1|
Domain Number - Region: 17-110
Classification Level Classification E-value
Superfamily Prefoldin 0.000654
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465380|ref|YP_001040489.1|
Sequence length 140
Comment hypothetical protein Smar_0472 [Staphylothermus marinus F1]
Sequence
MSAVVKEFSSFADLIKNIDEELNTLKQQLADYLRRLEDIRAKSEQERRLRELLKNLTGEE
QTSKGKVVDLKDVKLYVNPDAEQEATVMEEIIDRINKTIQSLQSIRKALEPLSNVEVEAK
IVVVYKEGVPSSIILKLSSM
Download sequence
Identical sequences A3DLS1
WP_011838772.1.69113 399550.Smar_0472 gi|126465380|ref|YP_001040489.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]