SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465451|ref|YP_001040560.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465451|ref|YP_001040560.1|
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.87e-29
Family FHA domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465451|ref|YP_001040560.1|
Sequence length 116
Comment FHA domain-containing protein [Staphylothermus marinus F1]
Sequence
MSKEQVEPKNSILILRVVKSNFFMPQTEWSLEPGEYVLGRYPTNDIVIPDPYVSRRHARI
FYENGEWYIEDLDSTNGTIVDNEDIRGKGPKKINNNSEIVVGLTILSATIEEKPQE
Download sequence
Identical sequences A3DLZ2
WP_011838843.1.69113 gi|126465451|ref|YP_001040560.1| 399550.Smar_0545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]