SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465505|ref|YP_001040614.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465505|ref|YP_001040614.1|
Domain Number 1 Region: 107-252
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.44e-17
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.045
Further Details:      
 
Domain Number 2 Region: 10-102
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.000000000000178
Family Ferredoxin reductase FAD-binding domain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465505|ref|YP_001040614.1|
Sequence length 258
Comment dihydroorotate oxidase B, electron transfer subunit [Staphylothermus marinus F1]
Sequence
MKTILSPSIKYYSIKLINNNKLSLNLYLLDFKILDNIITEPKPPQFIMLWVPGYEAIPMS
VAGFNSEDNTLSILVKPVGPTTRRLVSMSCGSYLGMYGFLGREHIPHGNKFLFVAGGSGL
APILYYLKYLGCTPDKCHVLFGCWRREEIGDAPRLISKLGGKPYTACFGECDYQGTILDA
YTKINLGEYDAIIVSGPPEMIGNMLNKVNNNVNHYFILEETIKCGLGLCGKCTLRNLGRL
LCIDGPLFNYEDTLRVYS
Download sequence
Identical sequences A3DM46
WP_011838897.1.69113 gi|126465505|ref|YP_001040614.1| 399550.Smar_0599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]