SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465615|ref|YP_001040724.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465615|ref|YP_001040724.1|
Domain Number 1 Region: 1-133,181-292
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.59e-40
Family tRNA pseudouridine synthase TruD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465615|ref|YP_001040724.1|
Sequence length 300
Comment hypothetical protein Smar_0713 [Staphylothermus marinus F1]
Sequence
MKAVRIVAKDLGIPEQNILFLGFKDRDSRSKQFFFIRKNIIYNRLSKEKTIHRDLEYVFI
GYVHRKPRRKDLTGNKFVLIVKDTDKKDRDIANNILNKIAKYGLPSYYGYQRFGLKRFNS
HLLGKYLLIDRIDLFIREFLKGIYPSESNESIYNRIFLGFEKLLYEKILVDTEDIFKAVN
KVNRMIRNILVDAYAAYLYNLLLNKIIEEKGWIGLDKVLPLPGCFDGINFYKDIFSVESL
DQNVMKRMGCWYRRGIFRPSNISLVLIGDALKISFLLESGMYASIIMRELFKDNLLFTQT
Download sequence
Identical sequences A3DMF6
399550.Smar_0713 gi|126465615|ref|YP_001040724.1| WP_011839007.1.69113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]