SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465679|ref|YP_001040788.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465679|ref|YP_001040788.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.3e-22
Family Hypothetical protein MJ0882 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465679|ref|YP_001040788.1|
Sequence length 186
Comment methyltransferase small [Staphylothermus marinus F1]
Sequence
MYEPSDDTWLLLETIRDNDYFNNCVDLGCGTGVVGLYLLSKNICSKTLFIDINPVALLNT
VYNLKLNNYQHKGLVASIDNDSILENYFELVVANPPYLPGTPENLYDYSLVGGSRGYEAV
LEFIDSAYYLLVENGVFYLVYSSLSQPIIIENYLSKKCFRIVRKNIKHFFFEDIIVVEAV
KKCMLE
Download sequence
Identical sequences A3DMM0
WP_011839071.1.69113 gi|126465679|ref|YP_001040788.1| 399550.Smar_0779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]