SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465759|ref|YP_001040868.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465759|ref|YP_001040868.1|
Domain Number 1 Region: 10-176,206-220
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-49
Family Ribonuclease PH domain 1-like 0.0000045
Further Details:      
 
Domain Number 2 Region: 192-276
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.24e-21
Family Ribonuclease PH domain 2-like 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465759|ref|YP_001040868.1|
Sequence length 285
Comment exosome complex RNA-binding protein Rrp42 [Staphylothermus marinus F1]
Sequence
MSLTPTRQPIVPKIKHETIKKLLKQGERIDGRKLDEYRPIEVFLNPIPKAEGSAAVKLGN
TFVITGVKLEIGTPYSDRPNEGVLQVHAEFVPLASPTFEPGPPDENAIETARVIDRSLRE
PRAIRLEDLVVIPGKKVWLIFNDLYLIDHYGNIVDTGMLSTMLALNMTKIPRIVSIEDEN
VVIDKTVKEAPLPLNLNVVTVTLGIIDDVIIVDPNIEEELVVDSRITFAVDETNRIVGIQ
KMGMKGIKPKMIDQLVDIALKKASELHSLLREVLNNPDTYIKTLV
Download sequence
Identical sequences A3DMV0
399550.Smar_0860 WP_011839151.1.69113 gi|126465759|ref|YP_001040868.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]