SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465763|ref|YP_001040872.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465763|ref|YP_001040872.1|
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily Prefoldin 2.75e-22
Family Prefoldin 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465763|ref|YP_001040872.1|
Sequence length 121
Comment prefoldin subunit beta [Staphylothermus marinus F1]
Sequence
MSQQRLPPEVQQTLTQYQALRENYAKLDAELKLVEAELADIDHILDTLKTMEQETDIYKM
VGHVLVKKPRDEIIKELEERKEILGIKKDKYKKQLEILEKQISDLEKRLRELLAKYGITV
A
Download sequence
Identical sequences A3DMV4
399550.Smar_0864 WP_011839155.1.69113 gi|126465763|ref|YP_001040872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]