SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465798|ref|YP_001040907.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465798|ref|YP_001040907.1|
Domain Number 1 Region: 1-75,163-337
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 3.84e-76
Family Pyruvate kinase 0.0000318
Further Details:      
 
Domain Number 2 Region: 318-453
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 1.06e-16
Family Pyruvate kinase, C-terminal domain 0.0073
Further Details:      
 
Domain Number 3 Region: 70-163
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000000733
Family Pyruvate kinase beta-barrel domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465798|ref|YP_001040907.1|
Sequence length 469
Comment pyruvate kinase [Staphylothermus marinus F1]
Sequence
MRKVKIITTIGPSSGKYEVLSRLIQEGVDGFRINFSHGNPHEWDEWVKMVRELAEKYERE
ISIMGDLPGPQVRIGELPVQEIKAKQTVKLVYKDKVDEENTIPVPNRKVFEILELGDIVL
IDDGKIILRIIDIGGNEAEAIVLNDAVLYPHKTLVVFGKEIDLPVLSEKDVDLVNYSVSR
KLTYLAISFVRRSSDIVIVRDIVSRLNGEIGLIAKIETRSAVKNLKDIMSVSDAIIIARG
DLGMHYSLEELPGLQRKIAREAIMIGKPSIVATQLLESMVNYPRPSRSEVVDVVNAVYDL
VDALLLTDETAIGKYPVESVKWLKRIISSAESSIVERRIEDIREKLELRALREKYALGLT
LLAEKINAKILIYTKTSTIPPAISRFRPQIPVYVGTSDKLIAEKLTIYYGLKPFYLKQLR
NKDIDYDQGVKTLYEHLKNKEEITYGEIIAEAYGRRETQIHEIKIRQVI
Download sequence
Identical sequences A3DMY9
WP_011839190.1.69113 399550.Smar_0899 gi|126465798|ref|YP_001040907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]