SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465879|ref|YP_001040988.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465879|ref|YP_001040988.1|
Domain Number 1 Region: 311-473
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.87e-56
Family DNA gyrase/MutL, second domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 21-231
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-38
Family DNA gyrase/MutL, N-terminal domain 0.000000367
Further Details:      
 
Domain Number 3 Region: 234-306
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.000000628
Family Topoisomerase VI-B subunit middle domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465879|ref|YP_001040988.1|
Sequence length 531
Comment DNA topoisomerase VI subunit B [Staphylothermus marinus F1]
Sequence
MAATSETAENYKAISAAEFFYKYKEIAGFANPARALYQTIRELVENALDATDAHGILPNI
KVTIEKADQIHEYYKITVEDNGIGIPPHIVPEAFGRVLFSSKYVLRQTRGMFGLGVKVAV
LYGQMTTGRPVEIITSQPGLRRIYYYKLRIDINKNQPIILERGSWRKNRDWHGTIVSLTI
EGDWSRARFRVKDYILRTAVVTPYANIVFMTPEGEIYYYKRAIDKLPSPPKQVKPHPYGV
DLELLKRIRETGKYATLYDLLIKSFQSVGDVTARTLISQAGLDPSIDPMKISDKDLLKLV
NTMKKYDKYRPPTAQALSPLGPDIIKAGLTRIYEPEFVEATTRKPSAYQGHPFIVEAGIA
YGGKVPMSPSDKPNLLRYANKIPLLYDEGSDVITAVIKEDINWDNYLVHLPAPIIVLVHI
CSTKVPFKGVGKESIADVPEIRKEIKLAISEVARKLRNHLSKKIREEEKKKKIVNLAKYI
PEVARALSIIIGEDGLDYNTILDKLAEITATRTGIPKNEVEKVIKNVEIGT
Download sequence
Identical sequences A3DN70
WP_011839271.1.69113 gi|126465879|ref|YP_001040988.1| 399550.Smar_0981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]