SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465919|ref|YP_001041028.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465919|ref|YP_001041028.1|
Domain Number 1 Region: 469-624
Classification Level Classification E-value
Superfamily vWA-like 6.67e-20
Family RoRNP C-terminal domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126465919|ref|YP_001041028.1|
Sequence length 645
Comment hypothetical protein Smar_1022 [Staphylothermus marinus F1]
Sequence
MRFSSENSMDNEKIIEHIKNVVLEGIEKYKNVGQSGSLSIDRAELFIKIYITLSELVKNR
LDKSVILEEFYRSFLPEKKYRLVEDETKISYDSKMSILRRIHGKNKITVSEIFRYSASSS
DILDYIWLRKNKLLLRGRDGKLVINKRIYSKQFDNEATRNLELKDVYKYLDEIPSVLWSR
ILTSSFLEKINNNELLGFLSKFYGYSSKVNRRLLSELRRRLANGWDPNWFEWKKISRIIE
DKSLKTEKYMGPYSLQWSTPKNLDVRKIIDDLENMPLKERWKIISKIYKNKNLLTILKKL
DPISLSSIGSLNRVPDLKDKILLGKSLANIITYMITGDESYLNYSMYFVEKINPDSLEPN
FRPIYRSIISGDKKKLLYYLGVIMPISSVEFITAKIWDIMSSNTGINREQLLRAIRIGYE
ILKYTASLSGTMLSKRKKISFIRGRMDVRKTVFNYSRFNYNIAKRDKEKEFRVNTLIDIS
GSMIKHSLWAIFSLASIMPIVKNIILFSDKVFINKPPSSLNRGLIVNYLEKLFIEGFKGY
TNISLALRTAEKLSKSNDYILLFSDLEQTVSDTKPWIIAEKLINKNKVNIVIFTPPYHDV
ETANMMERIGCIVVRTKSINDIFKWFKRGLNFKIRSKLIHVRGLR
Download sequence
Identical sequences A3DNB0
WP_011839311.1.69113 gi|126465919|ref|YP_001041028.1| 399550.Smar_1022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]