SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465936|ref|YP_001041045.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465936|ref|YP_001041045.1|
Domain Number 1 Region: 133-208
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.85e-23
Family Translational machinery components 0.0015
Further Details:      
 
Domain Number 2 Region: 49-120
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.93e-19
Family Ribosomal S5 protein, N-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126465936|ref|YP_001041045.1|
Sequence length 214
Comment 30S ribosomal protein S5 [Staphylothermus marinus F1]
Sequence
MPMSAIDKEALETWVPRTRVGKMVVEGKITSLKEIFDRNLPLLEPEIVDYLLPDLKYERL
DVGIVQKVTDAGRRSRFRVVVVVGNEDGFVGVGSGKARQYLVALRKALRNAKLNITPVRR
GCGSWECRCGEPHSIPFTVQGKSGSVVVVLKPAPKGTGLVAGDTAKAVLRMAGIKDVWTE
TFGKTKTTLNFAKAVVNALRNTYKFVAPVDWLKA
Download sequence
Identical sequences A3DNC7
399550.Smar_1039 WP_011839328.1.69113 gi|126465936|ref|YP_001041045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]