SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126465945|ref|YP_001041054.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126465945|ref|YP_001041054.1|
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily Pseudouridine synthase 6.04e-47
Family Pseudouridine synthase II TruB 0.00000508
Further Details:      
 
Domain Number 2 Region: 165-247
Classification Level Classification E-value
Superfamily PUA domain-like 4.53e-20
Family PUA domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126465945|ref|YP_001041054.1|
Sequence length 256
Comment tRNA pseudouridine synthase B [Staphylothermus marinus F1]
Sequence
MTGVLPVALANATKVIGNVIHTIKEYVMVIQLHTPVDNERLREVLRYFTGVIYQRPPLRS
SVKRVIRTRRIHYIDLLEHSDRYVLVRVGCEAGTYMRKLAHDIGLLLGVGAHMRELRRTR
TGPYKEDETLVRMQEVSEALYLWRNKGDERYLRKIILPVETAIAHLPKIIIRDTAVDAVA
HGAHLAVPGIVRLTKDVALNKTVAILTLKGELVALGTALKSAVEIANMKKGIVVRTKRVY
MKPGIYPAVWKKRQEQ
Download sequence
Identical sequences A3DND6
gi|126465945|ref|YP_001041054.1| 399550.Smar_1048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]