SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126466047|ref|YP_001041156.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466047|ref|YP_001041156.1|
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.73e-43
Family GHMP Kinase, N-terminal domain 0.00079
Further Details:      
 
Domain Number 2 Region: 209-304,331-412
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.56e-23
Family Mevalonate kinase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126466047|ref|YP_001041156.1|
Sequence length 424
Comment GHMP kinase [Staphylothermus marinus F1]
Sequence
MVDNDLIKYIVSEYKRFYDVEPEVIVSAPGRLDFLNTHQDYKGLPVVSVGINLRTYVAIS
RSPDKYSRVISLNMLRERRSFQDIFSVENVYLRENKWFGNYIRASIIALKQCCEGIGDVL
ALIYSDVPIAAGLASSAALLVSFIGSVNELYGLGLDKKDVAELAYHAEHDVMNIPCGRLD
QYGSAYGGIVKIETKPPYNIEELPGINGVFVVLDSGIKHSTGDIHPRRQAEINMGLRLLL
QMNDLSREIREKLASTYYAVKWDMIKYDEIKPYLNRLPDIPRKRIIFTLKMNDSTSLALE
VLRNNIPCFEKWVSVFGLEWRDKILEAMRSSDPVLSLIGLIMNYQHILLRDLYDVSLPKI
EKIRNVALSAGALGAKISGAGLGGSLIALTRDRETARRVLSNALNNGAVRGWIVDIDSGL
RRER
Download sequence
Identical sequences A3DNN8
WP_011839439.1.69113 gi|126466047|ref|YP_001041156.1| 399550.Smar_1153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]