SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126466058|ref|YP_001041167.1| from Staphylothermus marinus F1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126466058|ref|YP_001041167.1|
Domain Number 1 Region: 16-41,179-382
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.71e-26
Family FolH catalytic domain-like 0.07
Further Details:      
 
Weak hits

Sequence:  gi|126466058|ref|YP_001041167.1|
Domain Number - Region: 61-188
Classification Level Classification E-value
Superfamily PA domain 0.000484
Family PA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126466058|ref|YP_001041167.1|
Sequence length 538
Comment aminopeptidase [Staphylothermus marinus F1]
Sequence
MEYYVLRKDKFHREAIAGSEAEHQIASAIKEYFKEYSDWVKILKVPLDTWEEINCTISFH
DNVLDCKSMPFTLSGEVEGEPVFADYLGNKIVSNKQVSDSIVFIPFPDDPDDSKYVVLKL
YEHGAKAVVFYDILPGRYRRMVIIGDEDYSFSHGAPSPIPVASIKKEDYLRIYKEMPRRI
VFRSKTKITHNVHGYTVVAGINGRGDREIHVTAHHDHWFNGFSDNMVGVELLIQLMKKYR
KSWNGYNLVFISYTAEESGSPYFTSWYWIWGSRYYLELLEARNDTSKIIADVNVDAIYTY
PLHFNANPSLTDCINKLVEGGRGIYDGYDYTDFDSYSYTLHGIPAMTLHTFKEMKHIYHT
NLDDGSEVYDHIITNALETLDDTVRCINNNMPKYKHITKYIKEKLGDKAPLEARNLVSKL
ETINNKINEEASIRIITRELSSIIYVPSLDGLFTSDLLADIIEIIDKLDKIDQYIGKRIR
VKVVDREQFLDISPTNHNKEELLKSLQYALIQRINSYNRRIEDVIKNIVLRKKCEKQL
Download sequence
Identical sequences A3DNP9
gi|126466058|ref|YP_001041167.1| WP_011839450.1.69113 399550.Smar_1164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]